(data stored in ACNUC7421 zone)

EMBL: CP001402.PE335

CP001402.PE335       Location/Qualifiers
FT   CDS             293505..293855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40971"
FT                   /db_xref="GOA:C4KL06"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL06"
FT                   /protein_id="ACR40971.1"
FT                   /translation="MSELSPSRSRGRYLTGSVAMYWVGVAISRIVTLFLLPIGNYFWRY
FT                   VFLIGFMPKTKKKRSRSIILFLPILSDNHPNNMEPGIIPINDAANNKPYWAVVKEICLY
FT                   ITVTANDIAFKS"
     MSELSPSRSR GRYLTGSVAM YWVGVAISRI VTLFLLPIGN YFWRYVFLIG FMPKTKKKRS        60
     RSIILFLPIL SDNHPNNMEP GIIPINDAAN NKPYWAVVKE ICLYITVTAN DIAFKS           116
//

If you have problems or comments...

PBIL Back to PBIL home page