(data stored in ACNUC7421 zone)

EMBL: CP001402.PE337

CP001402.PE337       Location/Qualifiers
FT   CDS             complement(294855..295853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0341"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40973"
FT                   /db_xref="GOA:C4KL08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL08"
FT                   /protein_id="ACR40973.1"
FT                   /translation="MRNLAIKAINLTKRFGKSVAVDHINFEVYEGEIFGFLGPNGAGKS
FT                   TTIKMLTTVLTPSEGTAIVNGYDVIKQPAHVRQSIGVVPQEYTADEDLTGWENMMMMAG
FT                   LYGIPKKVAEERSKELLEMVELTYAVKRKVETYSGGMRRRLEIAMSLISRPKILFLDEP
FT                   TLGLDAQTRAAIWQYIMKLKEEYKMTIFVTTHYLEEADMYGDRIAIIDKGKILAIGSPK
FT                   ELKEKIGGDLVSLQTNNDELAIKVVSSIDGILNVKKANDGIRIKVRNGEEKAPEILESL
FT                   VKNGIKVSRMSITEPTMDEVYMEFTGKRLRDEEASAQEMFAFRRTMRRART"
     MRNLAIKAIN LTKRFGKSVA VDHINFEVYE GEIFGFLGPN GAGKSTTIKM LTTVLTPSEG        60
     TAIVNGYDVI KQPAHVRQSI GVVPQEYTAD EDLTGWENMM MMAGLYGIPK KVAEERSKEL       120
     LEMVELTYAV KRKVETYSGG MRRRLEIAMS LISRPKILFL DEPTLGLDAQ TRAAIWQYIM       180
     KLKEEYKMTI FVTTHYLEEA DMYGDRIAII DKGKILAIGS PKELKEKIGG DLVSLQTNND       240
     ELAIKVVSSI DGILNVKKAN DGIRIKVRNG EEKAPEILES LVKNGIKVSR MSITEPTMDE       300
     VYMEFTGKRL RDEEASAQEM FAFRRTMRRA RT                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page