(data stored in ACNUC7421 zone)

EMBL: CP001402.PE339

CP001402.PE339       Location/Qualifiers
FT   CDS             296655..296882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL10"
FT                   /protein_id="ACR40975.1"
FT                   /translation="MGTIKFIFGKPVDEPFDRENEIRQLVEMANRRQPTAIIGVRRIGK
FT                   TSVILKGLKMVETPKVYLSAVLCGLLQFIS"
     MGTIKFIFGK PVDEPFDREN EIRQLVEMAN RRQPTAIIGV RRIGKTSVIL KGLKMVETPK        60
     VYLSAVLCGL LQFIS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page