(data stored in ACNUC7421 zone)

EMBL: CP001402.PE34

CP001402.PE34        Location/Qualifiers
FT   CDS             complement(31481..31957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0034"
FT                   /product="Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40670"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF0"
FT                   /protein_id="ACR40670.1"
FT                   /translation="MHIIFDTSAFLAGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAIS
FT                   SGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNIL
FT                   KHVGIQFSSIKINKKVEKSFKFKYVCIDCKREFDIDYRECPYCGGKVVKRRIME"
     MHIIFDTSAF LAGLQLSLDR VYTTQEVINE IKDKYSRFNL EIAISSGKVI IMKPSTRSVE        60
     KVTKVLNLTK ERKLSNTDIS VIALALDLQP SIVFTDDLSV QNILKHVGIQ FSSIKINKKV       120
     EKSFKFKYVC IDCKREFDID YRECPYCGGK VVKRRIME                               158
//

If you have problems or comments...

PBIL Back to PBIL home page