(data stored in ACNUC7421 zone)

EMBL: CP001402.PE341

CP001402.PE341       Location/Qualifiers
FT   CDS             complement(297861..298355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0345"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40977"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL12"
FT                   /protein_id="ACR40977.1"
FT                   /translation="MVYSSSYRIILSANYLNRSPFFISMEDPKIIEEIFKNADHVFRYV
FT                   GAKVLLLEQGRAVVEIPFKEELTRRGNVLHGGIIMTAIDFTGGLAAFTVNDGVDQVTQE
FT                   LKVNFLEPMYKGPFRVEGKVLRKGSTVIVVEIEFRDAEGNLGAKALGSWYILRKKVQGA
FT                   L"
     MVYSSSYRII LSANYLNRSP FFISMEDPKI IEEIFKNADH VFRYVGAKVL LLEQGRAVVE        60
     IPFKEELTRR GNVLHGGIIM TAIDFTGGLA AFTVNDGVDQ VTQELKVNFL EPMYKGPFRV       120
     EGKVLRKGST VIVVEIEFRD AEGNLGAKAL GSWYILRKKV QGAL                        164
//

If you have problems or comments...

PBIL Back to PBIL home page