(data stored in ACNUC7421 zone)

EMBL: CP001402.PE345

CP001402.PE345       Location/Qualifiers
FT   CDS             complement(301548..301919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0351"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40981"
FT                   /db_xref="GOA:C4KL16"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL16"
FT                   /protein_id="ACR40981.1"
FT                   /translation="MLEELCKIYSKFNPKLVILFGSYARGDYTSESDIDVLVVSDIFSR
FT                   DPRESFGMAYNLKFPQVMPVAMNTQVFLKKLDEGSTFILEIIEDGKILCGEKEFEREVL
FT                   ERYKKIRKRFRRKGRLWEW"
     MLEELCKIYS KFNPKLVILF GSYARGDYTS ESDIDVLVVS DIFSRDPRES FGMAYNLKFP        60
     QVMPVAMNTQ VFLKKLDEGS TFILEIIEDG KILCGEKEFE REVLERYKKI RKRFRRKGRL       120
     WEW                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page