(data stored in ACNUC7421 zone)

EMBL: CP001402.PE348

CP001402.PE348       Location/Qualifiers
FT   CDS             303420..303680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40984"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL19"
FT                   /protein_id="ACR40984.1"
FT                   /translation="MSWKLKDLKGLSAPTDVKMCTVDDVVRQLKDKYKIDVEILTKIAT
FT                   DVLVKHLTEKKITIEDIKKNYSNVKDIDNIIEDILRLSGKL"
     MSWKLKDLKG LSAPTDVKMC TVDDVVRQLK DKYKIDVEIL TKIATDVLVK HLTEKKITIE        60
     DIKKNYSNVK DIDNIIEDIL RLSGKL                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page