(data stored in ACNUC7421 zone)

EMBL: CP001402.PE35

CP001402.PE35        Location/Qualifiers
FT   CDS             complement(31941..32690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0035"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40671"
FT                   /db_xref="GOA:C4KJF1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJF1"
FT                   /protein_id="ACR40671.1"
FT                   /translation="MRVKIVSKPTSQLNNIIEKIKNISTKLGFEVVDKDFDYVIAVGGD
FT                   GTLLRAVKQNKPVIAVKAGRRGLLMDVPVDKFEEALLRLKKGDYEEEEYMLLEMIYNDK
FT                   VELGFNEVGILYDRPEAIKVGISFDTERVSVEGDGVLVSTPQGSSGWGMSATNSLLYKD
FT                   LSAIEIIFVNPIFYYLRSVVIPPKPLTLRLEDKGYPQTARAVVDGEVVTLIKTNQEITV
FT                   RVSQRKAKILRFFKLDLIGEVLHAYHI"
     MRVKIVSKPT SQLNNIIEKI KNISTKLGFE VVDKDFDYVI AVGGDGTLLR AVKQNKPVIA        60
     VKAGRRGLLM DVPVDKFEEA LLRLKKGDYE EEEYMLLEMI YNDKVELGFN EVGILYDRPE       120
     AIKVGISFDT ERVSVEGDGV LVSTPQGSSG WGMSATNSLL YKDLSAIEII FVNPIFYYLR       180
     SVVIPPKPLT LRLEDKGYPQ TARAVVDGEV VTLIKTNQEI TVRVSQRKAK ILRFFKLDLI       240
     GEVLHAYHI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page