(data stored in ACNUC7421 zone)

EMBL: CP001402.PE356

CP001402.PE356       Location/Qualifiers
FT   CDS             309352..309711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40992"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL27"
FT                   /protein_id="ACR40992.1"
FT                   /translation="MDESPLFEWEWISDPLDCPPDERCSPELMVGTMIPLEGNHRPFRV
FT                   GMNQSQYQLAILSATILGTNYSTNSITPNQLSLGYNAIKIDFKTSFTFVSGNIYVIQLT
FT                   LSNGQTLNISVVYQP"
     MDESPLFEWE WISDPLDCPP DERCSPELMV GTMIPLEGNH RPFRVGMNQS QYQLAILSAT        60
     ILGTNYSTNS ITPNQLSLGY NAIKIDFKTS FTFVSGNIYV IQLTLSNGQT LNISVVYQP        119
//

If you have problems or comments...

PBIL Back to PBIL home page