(data stored in ACNUC7421 zone)

EMBL: CP001402.PE358

CP001402.PE358       Location/Qualifiers
FT   CDS             complement(310467..311483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0364"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40994"
FT                   /db_xref="GOA:C4KL29"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL29"
FT                   /protein_id="ACR40994.1"
FT                   /translation="MVEKEMEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRF
FT                   LAKAAGQRTIVIGATGCMYVANTTYYSTSWIVPWVHTQLGGSGAAALGTAAALRALMRK
FT                   GKIKQEPINVIAFCGDLGCADMGLSGVSNAMTYDYNLLIVLYDNESSANTDIQETSMTP
FT                   YGAQTSFSRPGKQRRIMKKRWKKSVVPMIIAGHRNIRYAATMTPAYPLDSINKIKKALA
FT                   IGGPTFIHSLDPCPKGWDYDPRFSHELGVLAAETGLWPLYEYIDGEIAYNEPTKSIVEG
FT                   RMKRKPVKEYLEKQGRFSHFTEEDIEHIQRMVDEMYEEWEIPGVMPIKSLNVKISDK"
     MVEKEMEEKV YKSIIKTIKD TPLEEFYTSG HRTCQGCESA LVMRFLAKAA GQRTIVIGAT        60
     GCMYVANTTY YSTSWIVPWV HTQLGGSGAA ALGTAAALRA LMRKGKIKQE PINVIAFCGD       120
     LGCADMGLSG VSNAMTYDYN LLIVLYDNES SANTDIQETS MTPYGAQTSF SRPGKQRRIM       180
     KKRWKKSVVP MIIAGHRNIR YAATMTPAYP LDSINKIKKA LAIGGPTFIH SLDPCPKGWD       240
     YDPRFSHELG VLAAETGLWP LYEYIDGEIA YNEPTKSIVE GRMKRKPVKE YLEKQGRFSH       300
     FTEEDIEHIQ RMVDEMYEEW EIPGVMPIKS LNVKISDK                               338
//

If you have problems or comments...

PBIL Back to PBIL home page