(data stored in ACNUC7421 zone)

EMBL: CP001402.PE359

CP001402.PE359       Location/Qualifiers
FT   CDS             complement(311502..312749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0365"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40995"
FT                   /db_xref="GOA:C4KL30"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL30"
FT                   /protein_id="ACR40995.1"
FT                   /translation="MTEVKKLVEKEVLMNGTQAVAHAAMYADVDVVAAYPIRPYTEVMD
FT                   TISKLIADGELDAEFIVAEGEHGQFETVKHASLAGARTLVGSSGVGWLYGMEAIVVTAT
FT                   DRAPVVAIIGNRALDDPGAYGVEHNDALMVRDVGWLLVWVDTAQEAFDTTLIAYRVAED
FT                   QRVLLPLGISMDGGFLTHSEQIVRLPPKELVKNFLPPYNRGKYLVHPDNPITVAPQVNE
FT                   DWVMEIRRQHEEAMERARGVIVEAYEEFKKVFGRYPGSTNELQMPENPFVEPYMVDDAE
FT                   VVLIGMGTVSKPMKVAIKSMRRQGYKVGMLRIRWFRPFPTQDVIKYLANSRVVCVVDRD
FT                   YSMGSPNRGGVIYHEIRSSLYDLDQRPRVMSFIGGLGGREITIQDVEKIIKIGYEHRDT
FT                   PITKPVYWVGVRGDPW"
     MTEVKKLVEK EVLMNGTQAV AHAAMYADVD VVAAYPIRPY TEVMDTISKL IADGELDAEF        60
     IVAEGEHGQF ETVKHASLAG ARTLVGSSGV GWLYGMEAIV VTATDRAPVV AIIGNRALDD       120
     PGAYGVEHND ALMVRDVGWL LVWVDTAQEA FDTTLIAYRV AEDQRVLLPL GISMDGGFLT       180
     HSEQIVRLPP KELVKNFLPP YNRGKYLVHP DNPITVAPQV NEDWVMEIRR QHEEAMERAR       240
     GVIVEAYEEF KKVFGRYPGS TNELQMPENP FVEPYMVDDA EVVLIGMGTV SKPMKVAIKS       300
     MRRQGYKVGM LRIRWFRPFP TQDVIKYLAN SRVVCVVDRD YSMGSPNRGG VIYHEIRSSL       360
     YDLDQRPRVM SFIGGLGGRE ITIQDVEKII KIGYEHRDTP ITKPVYWVGV RGDPW            415
//

If you have problems or comments...

PBIL Back to PBIL home page