(data stored in ACNUC7421 zone)

EMBL: CP001402.PE360

CP001402.PE360       Location/Qualifiers
FT   CDS             complement(312746..313837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2843"
FT                   /product="pyruvate ferredoxin, flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2843"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40996"
FT                   /db_xref="GOA:C4KL31"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL31"
FT                   /protein_id="ACR40996.1"
FT                   /translation="MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFG
FT                   RYGDSPERNGVPAKYYVGIGNGVNEEDLIGYSTRVEPDLVDTIIVLDDTLLKGVESWAW
FT                   QGVQPINLKLKSNGTMLVTSTKRINELLKMIPKKDFNWTLGVINTEPSFSGLWAFKDDL
FT                   TMEKVWGGLAKLRPDIIDLDHLIKYVSKKQDANKRISAVKEAYSSVDYRTVMKGEGIDF
FT                   VYNPPRLLTWQEMLEGTVIPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWIYCP
FT                   DECFDETPDGYYDIAYDYCVGCGICADVCPVKDCIVMVDESMFTDYRRPYEMWKENKAK
FT                   YKEWLKNVRQARKERVYVPGLGR"
     MGVKDEVKYV EIVYRGIFQK RLAKYIAEGI VYTAREMGRP ALSFGRYGDS PERNGVPAKY        60
     YVGIGNGVNE EDLIGYSTRV EPDLVDTIIV LDDTLLKGVE SWAWQGVQPI NLKLKSNGTM       120
     LVTSTKRINE LLKMIPKKDF NWTLGVINTE PSFSGLWAFK DDLTMEKVWG GLAKLRPDII       180
     DLDHLIKYVS KKQDANKRIS AVKEAYSSVD YRTVMKGEGI DFVYNPPRLL TWQEMLEGTV       240
     IPAVPRGKRN ELFKRGTTKF ERPTVDFDTC IKCKLCWIYC PDECFDETPD GYYDIAYDYC       300
     VGCGICADVC PVKDCIVMVD ESMFTDYRRP YEMWKENKAK YKEWLKNVRQ ARKERVYVPG       360
     LGR                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page