(data stored in ACNUC7421 zone)

EMBL: CP001402.PE363

CP001402.PE363       Location/Qualifiers
FT   CDS             complement(317841..318194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0369"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40999"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL34"
FT                   /protein_id="ACR40999.1"
FT                   /translation="MTLLDTSVLIDIIKGKINNVGDSLSIISIMEVIRVLDKVKRLKVL
FT                   DQLKKTYTIYPLDEKVAIEYSELYYELREKGKLISDLDLIIASTAKAYNERLVTKDKDF
FT                   LSLSGYIEIKLIQ"
     MTLLDTSVLI DIIKGKINNV GDSLSIISIM EVIRVLDKVK RLKVLDQLKK TYTIYPLDEK        60
     VAIEYSELYY ELREKGKLIS DLDLIIASTA KAYNERLVTK DKDFLSLSGY IEIKLIQ          117
//

If you have problems or comments...

PBIL Back to PBIL home page