(data stored in ACNUC7421 zone)

EMBL: CP001402.PE366

CP001402.PE366       Location/Qualifiers
FT   CDS             319742..320221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41002"
FT                   /db_xref="GOA:C4KL37"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL37"
FT                   /protein_id="ACR41002.1"
FT                   /translation="MSHNFLIVLAAVSLAYLGFNVRVPLMRVVIGKRMSKEELSTYFTI
FT                   TPLFSIVSPLISGFIAQESYTIDFVVAFIFIIIVIPILFIIKSIVPLTEEKPITTTSHI
FT                   PFKEYSKLMREDRSGLIFALAVSCEQVYFWNKFFVYSALFYRDNKGKSTGVGNNA"
     MSHNFLIVLA AVSLAYLGFN VRVPLMRVVI GKRMSKEELS TYFTITPLFS IVSPLISGFI        60
     AQESYTIDFV VAFIFIIIVI PILFIIKSIV PLTEEKPITT TSHIPFKEYS KLMREDRSGL       120
     IFALAVSCEQ VYFWNKFFVY SALFYRDNKG KSTGVGNNA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page