(data stored in ACNUC7421 zone)

EMBL: CP001402.PE367

CP001402.PE367       Location/Qualifiers
FT   CDS             320214..320618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41003"
FT                   /db_xref="GOA:C4KL38"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL38"
FT                   /protein_id="ACR41003.1"
FT                   /translation="MLSTETIAISLASSLSKFISDRLGNVTTLAMTRILAAITYPLLYF
FT                   VKSPVIFILINWVGTLFIAMDNVPEVSVISKMKTANLSMSLIDSVSTLLSISSPIIALY
FT                   IWVNISPATVFLLSLLVIIPSILMFKYKVD"
     MLSTETIAIS LASSLSKFIS DRLGNVTTLA MTRILAAITY PLLYFVKSPV IFILINWVGT        60
     LFIAMDNVPE VSVISKMKTA NLSMSLIDSV STLLSISSPI IALYIWVNIS PATVFLLSLL       120
     VIIPSILMFK YKVD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page