(data stored in ACNUC7421 zone)

EMBL: CP001402.PE370

CP001402.PE370       Location/Qualifiers
FT   CDS             323329..323694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0376"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41006"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL41"
FT                   /protein_id="ACR41006.1"
FT                   /translation="MKVAIAVTNGYVSGPGEGLAVQIYEINGNEYKIIEEYENPALNAT
FT                   AARGVHMLKSAIDKGVNAVVVAEMGPPGFRFLQRYNVKAYLGMGLDAKTALEKLIKNEL
FT                   LEITQPTHGERHGEHYH"
     MKVAIAVTNG YVSGPGEGLA VQIYEINGNE YKIIEEYENP ALNATAARGV HMLKSAIDKG        60
     VNAVVVAEMG PPGFRFLQRY NVKAYLGMGL DAKTALEKLI KNELLEITQP THGERHGEHY       120
     H                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page