(data stored in ACNUC7421 zone)

EMBL: CP001402.PE372

CP001402.PE372       Location/Qualifiers
FT   CDS             complement(323800..324270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41008"
FT                   /db_xref="GOA:C4KL43"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL43"
FT                   /protein_id="ACR41008.1"
FT                   /translation="MSNWNSTIFAKIQQIKGEYVCTFYLSGIFSNWINNRTSNDRCNPI
FT                   YFFKQRDRDNYNPSEIPTLIPILILGSLFFISFSTLLAILTIKFKEMRMQNLISFIPLI
FT                   LGFIFYSLFTSSEYPNILDYTSLYLSMMLLLYYGYTGNTTNKLSECTRKSIS"
     MSNWNSTIFA KIQQIKGEYV CTFYLSGIFS NWINNRTSND RCNPIYFFKQ RDRDNYNPSE        60
     IPTLIPILIL GSLFFISFST LLAILTIKFK EMRMQNLISF IPLILGFIFY SLFTSSEYPN       120
     ILDYTSLYLS MMLLLYYGYT GNTTNKLSEC TRKSIS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page