(data stored in ACNUC7421 zone)

EMBL: CP001402.PE374

CP001402.PE374       Location/Qualifiers
FT   CDS             324869..325060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0381"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41010"
FT                   /db_xref="GOA:C4KL45"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL45"
FT                   /protein_id="ACR41010.1"
FT                   /translation="MAGKFYVIVGILALLFIILYSLLPFYSKNDPTLLGLPLFYWYQII
FT                   LMPIGALVFYAVVMIIRD"
     MAGKFYVIVG ILALLFIILY SLLPFYSKND PTLLGLPLFY WYQIILMPIG ALVFYAVVMI        60
     IRD                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page