(data stored in ACNUC7421 zone)

EMBL: CP001402.PE377

CP001402.PE377       Location/Qualifiers
FT   CDS             complement(327621..328592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0384"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41013"
FT                   /db_xref="GOA:C4KL48"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL48"
FT                   /protein_id="ACR41013.1"
FT                   /translation="MMSYSEVEYKGLSYLKRGNIEIIIIILIELLAILVTYVMEYLGLP
FT                   TPLQDFLVLLPSSAISTLLIILTYLDIQRGFYTLGKAEVNIGIGNIISSLFLVLSILAI
FT                   VGVVTYTLSLIFNGITSSILNPIQTLVELFAFITFIMLGFSYRLIGNHYGSNHLSIGGI
FT                   VLILGVIIFIFKLEYGGLLAFIGLIITYIGLGNLSAMKKLVTAPPPTQASSTPSETTSS
FT                   TNVSSSSPTPNIITHGGILRSNGEAFIAVSSDIEEEILSSIILNTDYSTNEITPKKLSK
FT                   GYNSIKINFNTNLQQLTLGNTYTIRLISANGRNIDINVVFQL"
     MMSYSEVEYK GLSYLKRGNI EIIIIILIEL LAILVTYVME YLGLPTPLQD FLVLLPSSAI        60
     STLLIILTYL DIQRGFYTLG KAEVNIGIGN IISSLFLVLS ILAIVGVVTY TLSLIFNGIT       120
     SSILNPIQTL VELFAFITFI MLGFSYRLIG NHYGSNHLSI GGIVLILGVI IFIFKLEYGG       180
     LLAFIGLIIT YIGLGNLSAM KKLVTAPPPT QASSTPSETT SSTNVSSSSP TPNIITHGGI       240
     LRSNGEAFIA VSSDIEEEIL SSIILNTDYS TNEITPKKLS KGYNSIKINF NTNLQQLTLG       300
     NTYTIRLISA NGRNIDINVV FQL                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page