(data stored in ACNUC7421 zone)

EMBL: CP001402.PE378

CP001402.PE378       Location/Qualifiers
FT   CDS             complement(328641..329450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41014"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL49"
FT                   /protein_id="ACR41014.1"
FT                   /translation="MKKPKILLSVIKSLLENNGHITSRELPKSKKVSSNQLYKAILILN
FT                   KLGLIQIEGELNNNRFELHLVRDSQFLNLEQRVKVTFYEDRSKTKSFKFHTVALKNGVS
FT                   YIEDNSYWSVDDKVKTKLKVYKPKREFGKIIVEKIELGVQKAYIKLTLNPPTRVGEKII
FT                   HGFKVIQSNYFTFTQKETIERYGDPEMMDGLSVIQPTLFSTLEIKFPEGYRFIDVKAER
FT                   YDLVVIDGPQIPSPIPNHRLVIERNRIILKLVYPSFGYYFISWKAAQ"
     MKKPKILLSV IKSLLENNGH ITSRELPKSK KVSSNQLYKA ILILNKLGLI QIEGELNNNR        60
     FELHLVRDSQ FLNLEQRVKV TFYEDRSKTK SFKFHTVALK NGVSYIEDNS YWSVDDKVKT       120
     KLKVYKPKRE FGKIIVEKIE LGVQKAYIKL TLNPPTRVGE KIIHGFKVIQ SNYFTFTQKE       180
     TIERYGDPEM MDGLSVIQPT LFSTLEIKFP EGYRFIDVKA ERYDLVVIDG PQIPSPIPNH       240
     RLVIERNRII LKLVYPSFGY YFISWKAAQ                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page