(data stored in ACNUC7421 zone)

EMBL: CP001402.PE381

CP001402.PE381       Location/Qualifiers
FT   CDS             331982..332497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0387"
FT                   /product="protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41017"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL52"
FT                   /protein_id="ACR41017.1"
FT                   /translation="MLFTIGHSNRSLEDFMEILRKYNVEILIDVRRWPKSSRYPHFNKE
FT                   NLKKALEQSGIEYLWKEQLGGYRKIGKDVEDIDIGKCFKSEGFRAYAIYILTNERVMEA
FT                   LEDIRRINKIKVIMCSEKFPWNCHRKIISDWFLARGDEVVHLIEKESTIKHKLTTCAEI
FT                   VKNNLNYK"
     MLFTIGHSNR SLEDFMEILR KYNVEILIDV RRWPKSSRYP HFNKENLKKA LEQSGIEYLW        60
     KEQLGGYRKI GKDVEDIDIG KCFKSEGFRA YAIYILTNER VMEALEDIRR INKIKVIMCS       120
     EKFPWNCHRK IISDWFLARG DEVVHLIEKE STIKHKLTTC AEIVKNNLNY K                171
//

If you have problems or comments...

PBIL Back to PBIL home page