(data stored in ACNUC7421 zone)

EMBL: CP001402.PE385

CP001402.PE385       Location/Qualifiers
FT   CDS             complement(334563..335204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0391"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41021"
FT                   /db_xref="GOA:C4KDP8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP8"
FT                   /protein_id="ACR41021.1"
FT                   /translation="MKGLLIAFEGIDGSGKSSQAVLLKDWIEMRRDVYLTEWNSSDWIH
FT                   DIIKEAKKKNTLTPTTFSLIHATDFSDRYERFILPMLKSGFVVICDRYIYTAYARDVVR
FT                   NVDFNWVKKLYSFAIKPNFTFYIRVTPEVALERIKKAKRKIKPQEAGIDILGELPLEEG
FT                   FLKYQGMVVEIYDKIAKEESNFITIDGNRPLKDVQMDIRKILGEYIDNSL"
     MKGLLIAFEG IDGSGKSSQA VLLKDWIEMR RDVYLTEWNS SDWIHDIIKE AKKKNTLTPT        60
     TFSLIHATDF SDRYERFILP MLKSGFVVIC DRYIYTAYAR DVVRNVDFNW VKKLYSFAIK       120
     PNFTFYIRVT PEVALERIKK AKRKIKPQEA GIDILGELPL EEGFLKYQGM VVEIYDKIAK       180
     EESNFITIDG NRPLKDVQMD IRKILGEYID NSL                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page