(data stored in ACNUC7421 zone)

EMBL: CP001402.PE39

CP001402.PE39        Location/Qualifiers
FT   CDS             35299..36039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0039"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40675"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF5"
FT                   /protein_id="ACR40675.1"
FT                   /translation="MKTERLNAYFPGVRSYYIIGEIAIVTPKRVNVDYNLVAQKIMQAH
FT                   PKIKAVYLKKKVKGELRTNELEFLSGERISSTIYKENGVLFYVDIVTVYVNPSLSGDRL
FT                   KNVELVEEGSIILDAFTGYGAIALNIAHKKRAFVVAGDVNIDGLYMLKKSLSLNKIKGM
FT                   IDIVQYDAHYLPFRDKVFKLSFGDNPTLIIDFKEELCRVSENVVFYILCESKDKANSSL
FT                   GKTEWVKINDYSKNLFIFKGVVRC"
     MKTERLNAYF PGVRSYYIIG EIAIVTPKRV NVDYNLVAQK IMQAHPKIKA VYLKKKVKGE        60
     LRTNELEFLS GERISSTIYK ENGVLFYVDI VTVYVNPSLS GDRLKNVELV EEGSIILDAF       120
     TGYGAIALNI AHKKRAFVVA GDVNIDGLYM LKKSLSLNKI KGMIDIVQYD AHYLPFRDKV       180
     FKLSFGDNPT LIIDFKEELC RVSENVVFYI LCESKDKANS SLGKTEWVKI NDYSKNLFIF       240
     KGVVRC                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page