(data stored in ACNUC7421 zone)

EMBL: CP001402.PE390

CP001402.PE390       Location/Qualifiers
FT   CDS             complement(337881..338774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0395"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41026"
FT                   /db_xref="GOA:C4KDQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ3"
FT                   /protein_id="ACR41026.1"
FT                   /translation="MSSLVTPKRIPKFYRGNAACPGCPIPKELDVLLEVLGNKTVLVVP
FT                   ASCTTIIMGDTSGMPSTVPVIHSAFGAPAAIASGIVRALRTRGDKDVIVTVWAGDGSTG
FT                   DIGFASLSGAAERNEDILYVCYDNEAYMNTGIQRSSLTPKGAWTTTTPEGKREYKKPLP
FT                   FIIAEHKVPYVATASIAYIYDYEAKVRKAKQIRGFRYLHLLSPCPPGWRFDSKLTIDTA
FT                   KLAVETGVWPLFEIENGEFRLTSVSKTLLDKKNRKQVAEYLKLQGRFKQLTEEEIKGIQ
FT                   EEIDEMWEEIKKLVKK"
     MSSLVTPKRI PKFYRGNAAC PGCPIPKELD VLLEVLGNKT VLVVPASCTT IIMGDTSGMP        60
     STVPVIHSAF GAPAAIASGI VRALRTRGDK DVIVTVWAGD GSTGDIGFAS LSGAAERNED       120
     ILYVCYDNEA YMNTGIQRSS LTPKGAWTTT TPEGKREYKK PLPFIIAEHK VPYVATASIA       180
     YIYDYEAKVR KAKQIRGFRY LHLLSPCPPG WRFDSKLTID TAKLAVETGV WPLFEIENGE       240
     FRLTSVSKTL LDKKNRKQVA EYLKLQGRFK QLTEEEIKGI QEEIDEMWEE IKKLVKK          297
//

If you have problems or comments...

PBIL Back to PBIL home page