(data stored in ACNUC7421 zone)

EMBL: CP001402.PE392

CP001402.PE392       Location/Qualifiers
FT   CDS             complement(339932..340198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0397"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41028"
FT                   /db_xref="GOA:C4KDQ5"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ5"
FT                   /protein_id="ACR41028.1"
FT                   /translation="MIKIPMGVPVARPRIGSAGKTGLWRVEKPVIDYNKCTKCRLCVIY
FT                   CPENTIDLLENLYPQIDYDYCKGCGVCAQVCPPKAIDMVREVK"
     MIKIPMGVPV ARPRIGSAGK TGLWRVEKPV IDYNKCTKCR LCVIYCPENT IDLLENLYPQ        60
     IDYDYCKGCG VCAQVCPPKA IDMVREVK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page