(data stored in ACNUC7421 zone)

EMBL: CP001402.PE393

CP001402.PE393       Location/Qualifiers
FT   CDS             complement(340191..340739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0398"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41029"
FT                   /db_xref="GOA:C4KDQ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ6"
FT                   /protein_id="ACR41029.1"
FT                   /translation="MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERR
FT                   GAPVVSFLRLSDKPILLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPKR
FT                   IWKSEYIIDATSIAKELGLVVAGWAVVNTAMIGALVKILGQPSLHSLEETVKEEFPGKI
FT                   GELNAEAVEMGYKGVKRVD"
     MTLIELALRG RGGQGIVTAG ELVTKAMVLE DKYAQSIPFF GGERRGAPVV SFLRLSDKPI        60
     LLHREVYNPD GVAIFDTSLI QIINVTEGLK ENGFLLLNTN TPKRIWKSEY IIDATSIAKE       120
     LGLVVAGWAV VNTAMIGALV KILGQPSLHS LEETVKEEFP GKIGELNAEA VEMGYKGVKR       180
     VD                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page