(data stored in ACNUC7421 zone)

EMBL: CP001402.PE396

CP001402.PE396       Location/Qualifiers
FT   CDS             complement(342126..342587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41032"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ9"
FT                   /protein_id="ACR41032.1"
FT                   /translation="MPNEGIKLIFSLQTNLSFLIRTTEGKLTVLIRNAKNKYKSSTTLI
FT                   IMLEEWIKQLAYALDKFVADEQLTEDERIMVASLIYATLKHLKDFDECNEKLKEVEEKC
FT                   NKNPDELEKKLDELQKELDKKEVEVKEKLKTLDNLIKIMEVNPRLLPKN"
     MPNEGIKLIF SLQTNLSFLI RTTEGKLTVL IRNAKNKYKS STTLIIMLEE WIKQLAYALD        60
     KFVADEQLTE DERIMVASLI YATLKHLKDF DECNEKLKEV EEKCNKNPDE LEKKLDELQK       120
     ELDKKEVEVK EKLKTLDNLI KIMEVNPRLL PKN                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page