(data stored in ACNUC7421 zone)

EMBL: CP001402.PE397

CP001402.PE397       Location/Qualifiers
FT   CDS             342523..342993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR0"
FT                   /protein_id="ACR41033.1"
FT                   /translation="MRMRKLKLVCNEKINLMPSFGIMTDIVTEELKEELRKKLGREIPN
FT                   VSVEFVNYLPPQVLAYVRANDYTIYVNYEQYMRAKRMGYEYEYLYVILLHEYLHVVGIA
FT                   DEREVRRIDLEMVRDKFGENSTAYKIALNLADPRDIYLNESQRLGGKPNTFM"
     MRMRKLKLVC NEKINLMPSF GIMTDIVTEE LKEELRKKLG REIPNVSVEF VNYLPPQVLA        60
     YVRANDYTIY VNYEQYMRAK RMGYEYEYLY VILLHEYLHV VGIADEREVR RIDLEMVRDK       120
     FGENSTAYKI ALNLADPRDI YLNESQRLGG KPNTFM                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page