(data stored in ACNUC7421 zone)

EMBL: CP001402.PE399

CP001402.PE399       Location/Qualifiers
FT   CDS             343331..343513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41035"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR2"
FT                   /protein_id="ACR41035.1"
FT                   /translation="MVQLRVGKIKIQLEKGKVVMDKEFNISLCFLNAKLIKSRINDFRS
FT                   KASELIRLERIKRKI"
     MVQLRVGKIK IQLEKGKVVM DKEFNISLCF LNAKLIKSRI NDFRSKASEL IRLERIKRKI        60
//

If you have problems or comments...

PBIL Back to PBIL home page