(data stored in ACNUC7421 zone)

EMBL: CP001402.PE4

CP001402.PE4         Location/Qualifiers
FT   CDS             2400..3233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0004"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40640"
FT                   /db_xref="GOA:C4KJC0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC0"
FT                   /protein_id="ACR40640.1"
FT                   /translation="MIPVIIASAQTSVSQALSGIATSIIDAIPSIIVFIIILIIGYIIA
FT                   NIVSYSIRAFLGRIFREEHVRASVDIIAGTIKALIILIALSIALSFLQLGAASGYVQQI
FT                   ANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITV
FT                   AAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRLI
FT                   LYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK"
     MIPVIIASAQ TSVSQALSGI ATSIIDAIPS IIVFIIILII GYIIANIVSY SIRAFLGRIF        60
     REEHVRASVD IIAGTIKALI ILIALSIALS FLQLGAASGY VQQIANYLPK LAGAIVLLTI       120
     GLTLVNILVD YMQRQIGARS QDDLITAIFN VLRFGLYAAI ITVAAALAIF SVIPYVDPYV       180
     FYAVILGAVI LYAAYALIDK VLVPFANSNP DLAYVANYGR LILYIIVLLI AIAIIVEPFG       240
     NVTSIIYALS WGLAIAFAIA LIPLVIALVK KFLAEIK                                277
//

If you have problems or comments...

PBIL Back to PBIL home page