(data stored in ACNUC7421 zone)

EMBL: CP001402.PE40

CP001402.PE40        Location/Qualifiers
FT   CDS             complement(35962..36447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0040"
FT                   /product="Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40676"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF6"
FT                   /protein_id="ACR40676.1"
FT                   /translation="MIAIDKIKIKGHYNIRGLHKTTLEITKDHYLTTRGDCIIGILANK
FT                   GARDLSESFKKIARNDERFIYAVIRVKELFDIIHGRGSSKFTFENQNKIIFRKSTFIEG
FT                   STVMIRSDKAARDINREIINLLKTEVEGEVHILASDNPLEDKEILRIVVDLNPLSFT"
     MIAIDKIKIK GHYNIRGLHK TTLEITKDHY LTTRGDCIIG ILANKGARDL SESFKKIARN        60
     DERFIYAVIR VKELFDIIHG RGSSKFTFEN QNKIIFRKST FIEGSTVMIR SDKAARDINR       120
     EIINLLKTEV EGEVHILASD NPLEDKEILR IVVDLNPLSF T                           161
//

If you have problems or comments...

PBIL Back to PBIL home page