(data stored in ACNUC7421 zone)

EMBL: CP001402.PE400

CP001402.PE400       Location/Qualifiers
FT   CDS             343628..344971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0406"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41036"
FT                   /db_xref="GOA:C4KDR3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR3"
FT                   /protein_id="ACR41036.1"
FT                   /translation="MDFTELKDIEQKVEEREDFSGEKVRPLAVFFPKDEDEVVRIVRFA
FT                   KKNRLPIIPWGQGTSLTGAVSCDKNCILVDLSKMNKILEINDIDWYVRVQPGIKLIDLF
FT                   EELEKKGFMLPPDPASFFLCSVGGAVAESSGGMKGVRHGSFREWVLSLRVVLPNGEVIK
FT                   VGEPLRKNRAGYDLVHLFVGSEGTLGIVTEIWLRIIPIPKRKMVMIAAMLKDFESAGEV
FT                   IVGLRKNKILPELSEYVDADVVKALNKHLSANLKETEGGMLLISIEEDSVDDVLKVLEG
FT                   KAVDIKIAEGEEAEKLYSLRSQAAIAVKAESNKVFYAEDIVVPVSKLPEAIRRLREIGE
FT                   KYNTKFYVISHIGDGNLHPNIIIEDKVARENAFEEIARMAIELGGSVSGEHGIGVQKAK
FT                   LMAEQIVKHNGVSVLDLMYQIKKLIDPDDIMNPDKYVELAYKFLTSRG"
     MDFTELKDIE QKVEEREDFS GEKVRPLAVF FPKDEDEVVR IVRFAKKNRL PIIPWGQGTS        60
     LTGAVSCDKN CILVDLSKMN KILEINDIDW YVRVQPGIKL IDLFEELEKK GFMLPPDPAS       120
     FFLCSVGGAV AESSGGMKGV RHGSFREWVL SLRVVLPNGE VIKVGEPLRK NRAGYDLVHL       180
     FVGSEGTLGI VTEIWLRIIP IPKRKMVMIA AMLKDFESAG EVIVGLRKNK ILPELSEYVD       240
     ADVVKALNKH LSANLKETEG GMLLISIEED SVDDVLKVLE GKAVDIKIAE GEEAEKLYSL       300
     RSQAAIAVKA ESNKVFYAED IVVPVSKLPE AIRRLREIGE KYNTKFYVIS HIGDGNLHPN       360
     IIIEDKVARE NAFEEIARMA IELGGSVSGE HGIGVQKAKL MAEQIVKHNG VSVLDLMYQI       420
     KKLIDPDDIM NPDKYVELAY KFLTSRG                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page