(data stored in ACNUC7421 zone)

EMBL: CP001402.PE405

CP001402.PE405       Location/Qualifiers
FT   CDS             complement(348089..348775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0411"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41041"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR8"
FT                   /protein_id="ACR41041.1"
FT                   /translation="MNDRLLEITFSVEHENCWTNLVGKYIVKTLRFSVDTERNSIRSLI
FT                   VVDKKYKDLMNKIKRNNSFIGYSSISLTNDNKKILFDFRKRYKNSVMDIINSIDGIILD
FT                   GFKYDGKEYWRILLYESYINELREKLRSKGNVEFIGFHELNVTEDELTPYELKTLILAY
FT                   KNGYFDFPRRIKSDKISKLINISKSTFTYHLRSAESRIIKRYIDDLKFYNVINNISQQE
FT                   EERKDS"
     MNDRLLEITF SVEHENCWTN LVGKYIVKTL RFSVDTERNS IRSLIVVDKK YKDLMNKIKR        60
     NNSFIGYSSI SLTNDNKKIL FDFRKRYKNS VMDIINSIDG IILDGFKYDG KEYWRILLYE       120
     SYINELREKL RSKGNVEFIG FHELNVTEDE LTPYELKTLI LAYKNGYFDF PRRIKSDKIS       180
     KLINISKSTF TYHLRSAESR IIKRYIDDLK FYNVINNISQ QEEERKDS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page