(data stored in ACNUC7421 zone)

EMBL: CP001402.PE406

CP001402.PE406       Location/Qualifiers
FT   CDS             349009..350094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0412"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41042"
FT                   /db_xref="GOA:C4KDR9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR9"
FT                   /protein_id="ACR41042.1"
FT                   /translation="MKAARLVEFQKPLKIEDLEVPKVGKGDVLLKVISCGICRSDWHLW
FT                   RGDPALVAYMQWSGGKLPITQGHEVYGEVVEVGESVAKLKKGDKVVMPASSTGDNRTCK
FT                   YCMEGDSNVCDHLVIAGYGINGCFAEYMLVPERSVIDLVKVPDGIKPEWAALSSCGFGT
FT                   SWNAFTMKTNLKPGDMVLTIGAGGMGLSGIVIANALGAKVIAVDVNERSLEKAKILGSI
FT                   ETYKYSGKSEELNEIVEDIMRKYGSVDVVYDTTGIPEAVIPFLPLLRVHGTLLLAGLMM
FT                   KGKETFPLPADLVVAREIRIQGVLMLPAQKFDTIFKLMKEGKINLDPVTYKTISIYDVN
FT                   DAYKEMSEYKNAGRIIINKFS"
     MKAARLVEFQ KPLKIEDLEV PKVGKGDVLL KVISCGICRS DWHLWRGDPA LVAYMQWSGG        60
     KLPITQGHEV YGEVVEVGES VAKLKKGDKV VMPASSTGDN RTCKYCMEGD SNVCDHLVIA       120
     GYGINGCFAE YMLVPERSVI DLVKVPDGIK PEWAALSSCG FGTSWNAFTM KTNLKPGDMV       180
     LTIGAGGMGL SGIVIANALG AKVIAVDVNE RSLEKAKILG SIETYKYSGK SEELNEIVED       240
     IMRKYGSVDV VYDTTGIPEA VIPFLPLLRV HGTLLLAGLM MKGKETFPLP ADLVVAREIR       300
     IQGVLMLPAQ KFDTIFKLMK EGKINLDPVT YKTISIYDVN DAYKEMSEYK NAGRIIINKF       360
     S                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page