(data stored in ACNUC7421 zone)

EMBL: CP001402.PE41

CP001402.PE41        Location/Qualifiers
FT   CDS             complement(36407..36700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0041"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40677"
FT                   /db_xref="GOA:C4KJF7"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF7"
FT                   /protein_id="ACR40677.1"
FT                   /translation="MYSQEIKDLIKKTRAERADIRIGKYGVTEGMLNEIKRRLNEHKVI
FT                   KIKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTFILAKVDSNRQDKDQGAL"
     MYSQEIKDLI KKTRAERADI RIGKYGVTEG MLNEIKRRLN EHKVIKIKIG IKEIDDRKEF        60
     AKRVAEMVGA KLIEVRGYTF ILAKVDSNRQ DKDQGAL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page