(data stored in ACNUC7421 zone)

EMBL: CP001402.PE410

CP001402.PE410       Location/Qualifiers
FT   CDS             353062..353481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0416"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41046"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS3"
FT                   /protein_id="ACR41046.1"
FT                   /translation="MNVLNKLGISDELADMLISEAVKKAKELGVKVSIAIVDEGGELKA
FT                   FKRMDGAPILTIEIAIDKAWTAVSFGIPTHEWYNMLKDNPPLAMGFPKIPRLIIFGGGF
FT                   PIVYKGQVIGGIGISGGSAEQDMEIAKNTLKKLES"
     MNVLNKLGIS DELADMLISE AVKKAKELGV KVSIAIVDEG GELKAFKRMD GAPILTIEIA        60
     IDKAWTAVSF GIPTHEWYNM LKDNPPLAMG FPKIPRLIIF GGGFPIVYKG QVIGGIGISG       120
     GSAEQDMEIA KNTLKKLES                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page