(data stored in ACNUC7421 zone)

EMBL: CP001402.PE414

CP001402.PE414       Location/Qualifiers
FT   CDS             356154..357092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0420"
FT                   /product="YHS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41050"
FT                   /db_xref="GOA:C4KDS7"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS7"
FT                   /protein_id="ACR41050.1"
FT                   /translation="MTMSREGGLGQTRGEVKQALSNVSEGLMKNYRNTVEFAVRMREKG
FT                   PAYKEAGEYLIAKGFWLSLRLIGALTGVSMDYLTPLDARIMSYKEFITEWVGAQFKRLL
FT                   EDYGIRLPWYWKWFELELDHWHHDFIIGLYTWRRTLNVAFRGPTPDERKWLNEKYPHWE
FT                   KFFGRVWDLYIKKIIDGQIPLPLTAVHLCTVCQVPIQAPVNGKYLRIYLKEYKGKIYTF
FT                   DSPACLWIFDQEPDRYAGRRTYTQRVLEGMIQFTEEAYKDPKRLLEEVIWNMGQTEEGE
FT                   AGLDPTDGAYALLYKEKDQDFLNRIKKYTEG"
     MTMSREGGLG QTRGEVKQAL SNVSEGLMKN YRNTVEFAVR MREKGPAYKE AGEYLIAKGF        60
     WLSLRLIGAL TGVSMDYLTP LDARIMSYKE FITEWVGAQF KRLLEDYGIR LPWYWKWFEL       120
     ELDHWHHDFI IGLYTWRRTL NVAFRGPTPD ERKWLNEKYP HWEKFFGRVW DLYIKKIIDG       180
     QIPLPLTAVH LCTVCQVPIQ APVNGKYLRI YLKEYKGKIY TFDSPACLWI FDQEPDRYAG       240
     RRTYTQRVLE GMIQFTEEAY KDPKRLLEEV IWNMGQTEEG EAGLDPTDGA YALLYKEKDQ       300
     DFLNRIKKYT EG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page