(data stored in ACNUC7421 zone)

EMBL: CP001402.PE415

CP001402.PE415       Location/Qualifiers
FT   CDS             357098..357532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS8"
FT                   /protein_id="ACR41051.1"
FT                   /translation="MSMEAVPIVFVPEEGTVWLPAVLPTNITVEEAIEMLKSLTVNVLV
FT                   WEKKDKDLRLVNYFTGQVLELNAKVRDVIKPYDVFWLVWWPPKEEFWKPENQNDDIFKI
FT                   IKETEEAIKLAPRSPSVLFTDEIEKYSIVRRLEREGKLRA"
     MSMEAVPIVF VPEEGTVWLP AVLPTNITVE EAIEMLKSLT VNVLVWEKKD KDLRLVNYFT        60
     GQVLELNAKV RDVIKPYDVF WLVWWPPKEE FWKPENQNDD IFKIIKETEE AIKLAPRSPS       120
     VLFTDEIEKY SIVRRLEREG KLRA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page