(data stored in ACNUC7421 zone)

EMBL: CP001402.PE416

CP001402.PE416       Location/Qualifiers
FT   CDS             357537..357941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0422"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41052"
FT                   /db_xref="GOA:C4KDS9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS9"
FT                   /protein_id="ACR41052.1"
FT                   /translation="MSYPGEFHKVLTLDDIYEGEAKLVEVNRYEILVVNINGEIKAYYA
FT                   RCAHALGLIEPNSFDGEEKIICPVHLWEYNARTGESINPEGSSLFPLDVKVEGNDIFVK
FT                   VPSIPVSEFKVKWFGMYRQRGVINEFGVNS"
     MSYPGEFHKV LTLDDIYEGE AKLVEVNRYE ILVVNINGEI KAYYARCAHA LGLIEPNSFD        60
     GEEKIICPVH LWEYNARTGE SINPEGSSLF PLDVKVEGND IFVKVPSIPV SEFKVKWFGM       120
     YRQRGVINEF GVNS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page