(data stored in ACNUC7421 zone)

EMBL: CP001402.PE419

CP001402.PE419       Location/Qualifiers
FT   CDS             359407..359880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0425"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41055"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT2"
FT                   /protein_id="ACR41055.1"
FT                   /translation="MKDKIVEILRQIYDPEIPINIYDLGLVREIKVEDNRVFVRLIFTA
FT                   NKGCTLADLMAVQVKYKLMKAFPDYNVEVKSDFNEEWNIGYATETGRLMLEEIYGKEAV
FT                   DALANKTKIEEIVSINKVRLEDFDPREYMKKAVDERYKRFKEWYDKHDILISH"
     MKDKIVEILR QIYDPEIPIN IYDLGLVREI KVEDNRVFVR LIFTANKGCT LADLMAVQVK        60
     YKLMKAFPDY NVEVKSDFNE EWNIGYATET GRLMLEEIYG KEAVDALANK TKIEEIVSIN       120
     KVRLEDFDPR EYMKKAVDER YKRFKEWYDK HDILISH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page