(data stored in ACNUC7421 zone)

EMBL: CP001402.PE42

CP001402.PE42        Location/Qualifiers
FT   CDS             complement(36660..36974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0042"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40678"
FT                   /db_xref="GOA:C4KJF8"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJF8"
FT                   /protein_id="ACR40678.1"
FT                   /translation="MRIKNKIKKRIIELIELAYITARKGDLELAREYIKLAEMYSRKGR
FT                   VKIPLKYKRMFCRKCYTPLITGVTERRRIRSKILIRTCLICNWQRRYVLSRNKGSNKEN
FT                   "
     MRIKNKIKKR IIELIELAYI TARKGDLELA REYIKLAEMY SRKGRVKIPL KYKRMFCRKC        60
     YTPLITGVTE RRRIRSKILI RTCLICNWQR RYVLSRNKGS NKEN                        104
//

If you have problems or comments...

PBIL Back to PBIL home page