(data stored in ACNUC7421 zone)

EMBL: CP001402.PE420

CP001402.PE420       Location/Qualifiers
FT   CDS             359946..361619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0426"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41056"
FT                   /db_xref="GOA:C4KDT3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT3"
FT                   /protein_id="ACR41056.1"
FT                   /translation="MRVKSLIFMNGSKLLLTLLKDYDVKHIFGLPGESSISLYDQLKEG
FT                   EVLHIITRDERNAVYMADTYAKLTYKPGVVEGPSVGSIYMLPGVAEAYKSSTPLIVITT
FT                   DTPLYGEKENYLTALDQASLFRPITKETITVYNVEELPHAIRRAFRLSTSGKPGPVHIR
FT                   ILLDVLEDELKGNVELKAQKEFSKYPSQRPLADREMIRKAVDLILKSEFPVIICGQGAL
FT                   YSMAWDEVTELAELLGILVGTTITGKGCIPETHPLSIGVVGGRGGANFSNSIVDKSDLV
FT                   ILIGSNTDSANTYNWTIPSRGKTVIHIDISETETGNNYDSINLIGDAKVTLRELIKEIK
FT                   GSGKIDKKNIILDRSAFEDRLSKERREAVNPLRFIKELWSLSPEEAVLIADPGVSAIYT
FT                   AAFYKAKKVGRYFIFNYGLGGLGYSIPASVGAYFARPNSLIFSLSGDGSFGFSAGELET
FT                   IRRVNANVVIIIFNNGSYGWIRAEMKARGKDIVGTDFSSPDYVKIAEGYGLSAYGITND
FT                   EEISDTLKRAIKNTPSLVEVIVEPEDKFVPPVMPWSKRFL"
     MRVKSLIFMN GSKLLLTLLK DYDVKHIFGL PGESSISLYD QLKEGEVLHI ITRDERNAVY        60
     MADTYAKLTY KPGVVEGPSV GSIYMLPGVA EAYKSSTPLI VITTDTPLYG EKENYLTALD       120
     QASLFRPITK ETITVYNVEE LPHAIRRAFR LSTSGKPGPV HIRILLDVLE DELKGNVELK       180
     AQKEFSKYPS QRPLADREMI RKAVDLILKS EFPVIICGQG ALYSMAWDEV TELAELLGIL       240
     VGTTITGKGC IPETHPLSIG VVGGRGGANF SNSIVDKSDL VILIGSNTDS ANTYNWTIPS       300
     RGKTVIHIDI SETETGNNYD SINLIGDAKV TLRELIKEIK GSGKIDKKNI ILDRSAFEDR       360
     LSKERREAVN PLRFIKELWS LSPEEAVLIA DPGVSAIYTA AFYKAKKVGR YFIFNYGLGG       420
     LGYSIPASVG AYFARPNSLI FSLSGDGSFG FSAGELETIR RVNANVVIII FNNGSYGWIR       480
     AEMKARGKDI VGTDFSSPDY VKIAEGYGLS AYGITNDEEI SDTLKRAIKN TPSLVEVIVE       540
     PEDKFVPPVM PWSKRFL                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page