(data stored in ACNUC7421 zone)

EMBL: CP001402.PE421

CP001402.PE421       Location/Qualifiers
FT   CDS             361644..361838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT4"
FT                   /protein_id="ACR41057.1"
FT                   /translation="MALLYNTVTTLYASPFLWNIESAQDQVIMNFNPYPNVHVNMSNIK
FT                   KIYFKEYEILPRKGWSFDI"
     MALLYNTVTT LYASPFLWNI ESAQDQVIMN FNPYPNVHVN MSNIKKIYFK EYEILPRKGW        60
     SFDI                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page