(data stored in ACNUC7421 zone)

EMBL: CP001402.PE422

CP001402.PE422       Location/Qualifiers
FT   CDS             complement(362377..363255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0428"
FT                   /product="Pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41058"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT5"
FT                   /protein_id="ACR41058.1"
FT                   /translation="MIRGIDGVIKGRNTMDGAGVKLYRVFGGPDTVDLTDPFLLLDFFG
FT                   SNKVEEYINGFPWHPHRGIETVTLLFEGKVEHQDSLGNKGTIYPGQVQWMTAGSGIFHQ
FT                   EMPKPLEGTEIPKYNQDPFLVRGLQLWINLPSYKKMTQPVYRDVKSVPKEKFDFGEVSV
FT                   LAGEFAGIEGPVKVKSDVDPSYIHVKLNGDMKLKVKEGYTVLAYVVDGSARFAPNSPDI
FT                   GKGNLVIFTREGDEIKISGNASFIVLSGRPLNEPVAWYGPIVMNTEDQIIEAFDDLRKG
FT                   TFIRHKEILYE"
     MIRGIDGVIK GRNTMDGAGV KLYRVFGGPD TVDLTDPFLL LDFFGSNKVE EYINGFPWHP        60
     HRGIETVTLL FEGKVEHQDS LGNKGTIYPG QVQWMTAGSG IFHQEMPKPL EGTEIPKYNQ       120
     DPFLVRGLQL WINLPSYKKM TQPVYRDVKS VPKEKFDFGE VSVLAGEFAG IEGPVKVKSD       180
     VDPSYIHVKL NGDMKLKVKE GYTVLAYVVD GSARFAPNSP DIGKGNLVIF TREGDEIKIS       240
     GNASFIVLSG RPLNEPVAWY GPIVMNTEDQ IIEAFDDLRK GTFIRHKEIL YE               292
//

If you have problems or comments...

PBIL Back to PBIL home page