(data stored in ACNUC7421 zone)

EMBL: CP001402.PE426

CP001402.PE426       Location/Qualifiers
FT   CDS             366382..367425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0432"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41062"
FT                   /db_xref="GOA:C4KDT9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT9"
FT                   /protein_id="ACR41062.1"
FT                   /translation="MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMR
FT                   QGRFGNLRIVEDLGVKLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYC
FT                   RIGEEHLCDSPRWLGINFDGAYAEYVLIPHYKYMYKLRRLNAVEASPLTCSGITTYRAV
FT                   RKASLDPTKTLVVVGAGGGLGTMAVQIAKAVGGATIIGVDVREEAVETAKRAGADYVIN
FT                   ASVQDPLAEIRRITEGKGIDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHA
FT                   PLITLSEIQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAV
FT                   GRQVLIP"
     MRAVRLVEIG KPLVLKDIDI PKPKGAQVLI KVEAAGVCHS DVHMRQGRFG NLRIVEDLGV        60
     KLPVTLGHEI AGKIEEMGDE VVGYSKGDLV AVNPWQGEGN CYYCRIGEEH LCDSPRWLGI       120
     NFDGAYAEYV LIPHYKYMYK LRRLNAVEAS PLTCSGITTY RAVRKASLDP TKTLVVVGAG       180
     GGLGTMAVQI AKAVGGATII GVDVREEAVE TAKRAGADYV INASVQDPLA EIRRITEGKG       240
     IDAVIDLNNS EKTLSVYPKA LAKQGKYIMV GLFGADLHFH APLITLSEIQ FVGSLVGNQS       300
     DFLGIMRLAE AGKVKPMITK TMKLEEANEA IDNLENFKAV GRQVLIP                     347
//

If you have problems or comments...

PBIL Back to PBIL home page