(data stored in ACNUC7421 zone)

EMBL: CP001402.PE429

CP001402.PE429       Location/Qualifiers
FT   CDS             complement(370899..371492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41065"
FT                   /db_xref="GOA:C4KDU2"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU2"
FT                   /protein_id="ACR41065.1"
FT                   /translation="MKKAELLFNAYKSRKEIEPFPLTEDEAKKVKEEFIEILINSEGLG
FT                   GYKLSGFGEGVLTKPMITRENMVELWFRNHKLEVEIVTLVENGEVKRTFLGLEIPAPRF
FT                   TTWDLPSHYIVADNIFAARLYVGPEIDPPFGSFKLYINDKFVGEGEPKYKPEEKVKEYM
FT                   KGYVSLGVFIGPTSVKKGDKIRVEGKKSISVSLI"
     MKKAELLFNA YKSRKEIEPF PLTEDEAKKV KEEFIEILIN SEGLGGYKLS GFGEGVLTKP        60
     MITRENMVEL WFRNHKLEVE IVTLVENGEV KRTFLGLEIP APRFTTWDLP SHYIVADNIF       120
     AARLYVGPEI DPPFGSFKLY INDKFVGEGE PKYKPEEKVK EYMKGYVSLG VFIGPTSVKK       180
     GDKIRVEGKK SISVSLI                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page