(data stored in ACNUC7421 zone)

EMBL: CP001402.PE43

CP001402.PE43        Location/Qualifiers
FT   CDS             36996..37667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0043"
FT                   /product="Suppressor Mra1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40679"
FT                   /db_xref="GOA:C4KJF9"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF9"
FT                   /protein_id="ACR40679.1"
FT                   /translation="MLKYSMHLNIVLLEASLELVPKEIVNHPAVIKNAKRRNKKPEETL
FT                   LDISLHYHAMKSLENSHKRGRPDILHQALLVILNDPVIKGDLFIHTIQSKIIKVNPNMR
FT                   PPKNYLRFMGLMEQLLKYGRIPINGDESLMEVTNLTLEEIAARYNLILLSEKGEKINPE
FT                   ELCKLDEKWILGIGTFPHGDFSEKILSLAKKIYSISEFQLETQQVLCRIFSACNSILGW
FT                   P"
     MLKYSMHLNI VLLEASLELV PKEIVNHPAV IKNAKRRNKK PEETLLDISL HYHAMKSLEN        60
     SHKRGRPDIL HQALLVILND PVIKGDLFIH TIQSKIIKVN PNMRPPKNYL RFMGLMEQLL       120
     KYGRIPINGD ESLMEVTNLT LEEIAARYNL ILLSEKGEKI NPEELCKLDE KWILGIGTFP       180
     HGDFSEKILS LAKKIYSISE FQLETQQVLC RIFSACNSIL GWP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page