(data stored in ACNUC7421 zone)

EMBL: CP001402.PE434

CP001402.PE434       Location/Qualifiers
FT   CDS             complement(375528..376061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0440"
FT                   /product="Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41070"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU7"
FT                   /protein_id="ACR41070.1"
FT                   /translation="MYKNPYGLEIHLIKGDITEVEADAIVNAANSYLQHGGGVAYAIVK
FT                   KGGYVIQKESDEYVEKYGPVPVGEVAVTSAGKLKSKYVIHTVGPRYGIEGKDKLESAIF
FT                   KSLLKADELSLTSIALPAISTGIYGYPYEICARAMANILKNYKAKSLRKVIVCLYSQDA
FT                   YDIFKKVFDSILKS"
     MYKNPYGLEI HLIKGDITEV EADAIVNAAN SYLQHGGGVA YAIVKKGGYV IQKESDEYVE        60
     KYGPVPVGEV AVTSAGKLKS KYVIHTVGPR YGIEGKDKLE SAIFKSLLKA DELSLTSIAL       120
     PAISTGIYGY PYEICARAMA NILKNYKAKS LRKVIVCLYS QDAYDIFKKV FDSILKS          177
//

If you have problems or comments...

PBIL Back to PBIL home page