(data stored in ACNUC7421 zone)

EMBL: CP001402.PE436

CP001402.PE436       Location/Qualifiers
FT   CDS             377366..377926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0442"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41072"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU9"
FT                   /protein_id="ACR41072.1"
FT                   /translation="MQVLIVAPHPDDETLCCGGVVQIFKERGYKVSVVVVTDGRYGSPD
FT                   EKLKGSMELVEIRRQEALRASKILGIDEITFLSFEDSKVIEKEVEKALVEFLHDKDIVL
FT                   SPIPFDSHPDHAKIGKVMEKLYPKAYFYLIWGSMQANWREVRFDIRKYREVKIRAINEY
FT                   KSQIGGLHLDRFTGDYEVFWMKV"
     MQVLIVAPHP DDETLCCGGV VQIFKERGYK VSVVVVTDGR YGSPDEKLKG SMELVEIRRQ        60
     EALRASKILG IDEITFLSFE DSKVIEKEVE KALVEFLHDK DIVLSPIPFD SHPDHAKIGK       120
     VMEKLYPKAY FYLIWGSMQA NWREVRFDIR KYREVKIRAI NEYKSQIGGL HLDRFTGDYE       180
     VFWMKV                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page