(data stored in ACNUC7421 zone)

EMBL: CP001402.PE437

CP001402.PE437       Location/Qualifiers
FT   CDS             377930..378367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41073"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV0"
FT                   /protein_id="ACR41073.1"
FT                   /translation="MEFEVLYIADDVLYRTLGELLGNYVKTLLEKSGQGKRLSEQEYLI
FT                   LMNYYNSKNMDYVFTELRNIRNELRGIMEITDRKSKEAMDYTDKSRKEAMEYDEKNKKE
FT                   VIDYVDKTKKEILDYVDKRFEAINKRFEDLRELILTLAKEA"
     MEFEVLYIAD DVLYRTLGEL LGNYVKTLLE KSGQGKRLSE QEYLILMNYY NSKNMDYVFT        60
     ELRNIRNELR GIMEITDRKS KEAMDYTDKS RKEAMEYDEK NKKEVIDYVD KTKKEILDYV       120
     DKRFEAINKR FEDLRELILT LAKEA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page